TTR, Recombinant, Pongo abelii, aa21-147, His-SUMO-Tag (Transthyretin)

Artikelnummer: USB-375708
Artikelname: TTR, Recombinant, Pongo abelii, aa21-147, His-SUMO-Tag (Transthyretin)
Artikelnummer: USB-375708
Hersteller Artikelnummer: 375708
Alternativnummer: USB-375708-20,USB-375708-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain. Source: Recombinant protein corresponding to aa21-147 from pongo abelii Transthyretin, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.7kD Amino Acid Sequence: GPTGAGESKCPLMVKVLDAVRGSPAVNVAVNVFKRAADETWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFAANDSGPRRYTIAALLSPYSYSTTAVVTNPKE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 29.7
UniProt: Q5NVS2
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.