TXN2, Recombinant, Human, aa1-166, GST-Tag (Thioredoxin, Mitochondrial)

Artikelnummer: USB-375725
Artikelname: TXN2, Recombinant, Human, aa1-166, GST-Tag (Thioredoxin, Mitochondrial)
Artikelnummer: USB-375725
Hersteller Artikelnummer: 375725
Alternativnummer: USB-375725-20,USB-375725-100,USB-375725-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Important for the control of mitochondrial reactive oxygen species homeostasis, apoptosis regulation and cell viability. Possesses a dithiol-reducing activity. Source: Recombinant protein corresponding to aa1-166 from human TXN2, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~38.9kD Amino Acid Sequence: TTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 38.9
UniProt: Q99757
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.