Uncharacterized Protein C4orf3, Recombinant, Human, aa1-44, His-SUMO-Tag (C4orf3)

Artikelnummer: USB-375777
Artikelname: Uncharacterized Protein C4orf3, Recombinant, Human, aa1-44, His-SUMO-Tag (C4orf3)
Artikelnummer: USB-375777
Hersteller Artikelnummer: 375777
Alternativnummer: USB-375777-20,USB-375777-100,USB-375777-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa1-44 from human C4orf3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~20.8kD Amino Acid Sequence: MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKHSY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 20.8
UniProt: Q8WVX3
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.