Uncharacterized Protein KIAA1377, Recombinant, Human, aa559-670, His-SUMO-Tag (KIAA1377)

Artikelnummer: USB-375779
Artikelname: Uncharacterized Protein KIAA1377, Recombinant, Human, aa559-670, His-SUMO-Tag (KIAA1377)
Artikelnummer: USB-375779
Hersteller Artikelnummer: 375779
Alternativnummer: USB-375779-20,USB-375779-100,USB-375779-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Participates in cytokinesis. Necessary for microtubules and mitotic spindle organization. Involved in primary cilium formation. Source: Recombinant protein corresponding to aa559-670 from human KIAA1377, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~28.9kD Amino Acid Sequence: HKKMKYNIHERNGVRFLKSILKKESKYEHGYLKALIINQSFKFGNQKAAAIRDSIELTKEKGAEIPKTIKKLRWFDETSNIENNAENSHSLKNKTGTTQQHSQQFHIQSGAG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 28.9
UniProt: Q9P2H0
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.