Uncharacterized Protein YnaB, Recombinant, Bacillus subtilis, aa1-144, His-SUMO-Tag (YnaB)

Produktübersicht

• Artikelname: Uncharacterized Protein YnaB, Recombinant, Bacillus subtilis, aa1-144, His-SUMO-Tag (YnaB)
• Artikelnummer: USB-375782
• Hersteller Artikelnummer: 375782
• Alternativnummer: USB-375782-20,USB-375782-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa1-144 from bacillus subtilis Uncharacterized Protein ynaB, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.8kD Amino Acid Sequence: MEDATFHFKDPASPQEISDIEQKLGVTFPNDYKEFLLQHNGMEMFDGIEILSLEGIIEYNEVQDFPEGYVLIGYHFDGRYVIDTNKSKNGLGYMLYLDSIDDIEDAINLDSNFEIWFDMLVSLNGTKYWEVNPNLQEYYKLVSE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 32.8
• UniProt: P94480
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.