Universal Stress Protein A, Recombinant, Salmonella Typhi, aa2-144, His-Tag (UspA)

Produktübersicht

• Artikelname: Universal Stress Protein A, Recombinant, Salmonella Typhi, aa2-144, His-Tag (UspA)
• Artikelnummer: USB-375783
• Hersteller Artikelnummer: 375783
• Alternativnummer: USB-375783-20, USB-375783-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Required for resistance to DNA-damaging agents. Source: Recombinant protein corresponding to aa2-144 from salmonella typhi Universal Stress Protein A, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.9kD Amino Acid Sequence: AYKHILIAVDLSPESKVLVEKAVSMARPYNAKISLIHVDVNYSDLYTGLIDVNLGDMQKRISKETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 17.9
• UniProt: Q8Z268
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.