UQCR10, Recombinant, Human, aa1-63, GST-Tag (Cytochrome b-c1 Complex Subunit 9)

Artikelnummer: USB-375787
Artikelname: UQCR10, Recombinant, Human, aa1-63, GST-Tag (Cytochrome b-c1 Complex Subunit 9)
Artikelnummer: USB-375787
Hersteller Artikelnummer: 375787
Alternativnummer: USB-375787-20,USB-375787-100
Hersteller: US Biological
Kategorie: Molekularbiologie
This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome c1. Source: Recombinant protein corresponding to aa1-63 from human UQCR10, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.2kD Amino Acid Sequence: AAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 34.2
UniProt: Q9UDW1
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.