UQCR11, Recombinant, Human, aa1-56, GST-Tag (Cytochrome b-c1 Complex Subunit 10 Protein)

Artikelnummer: USB-375788
Artikelname: UQCR11, Recombinant, Human, aa1-56, GST-Tag (Cytochrome b-c1 Complex Subunit 10 Protein)
Artikelnummer: USB-375788
Hersteller Artikelnummer: 375788
Alternativnummer: USB-375788-20,USB-375788-100,USB-375788-1
Hersteller: US Biological
Kategorie: Molekularbiologie
This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may be closely linked to the iron-sulfur protein in the complex and function as an iron-sulfur protein binding factor. Source: Recombinant protein corresponding to aa1-56 from human UQCR11, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33.6kD Amino Acid Sequence: MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 33.6
UniProt: O14957
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.