VPS13A, Recombinant, Human, aa3037-3140, His-SUMO-Tag (Vacuolar Protein Sorting-associated Protein 13A)

Artikelnummer: USB-375844
Artikelname: VPS13A, Recombinant, Human, aa3037-3140, His-SUMO-Tag (Vacuolar Protein Sorting-associated Protein 13A)
Artikelnummer: USB-375844
Hersteller Artikelnummer: 375844
Alternativnummer: USB-375844-20,USB-375844-100,USB-375844-1
Hersteller: US Biological
Kategorie: Molekularbiologie
May play a role in the control of protein cycling through the trans-Golgi network to early and late endosomes, lysosomes and plasma membrane. Partial recombinant protein corresponding to aa3037-3140 from human VPS13A, fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~28.5kD Amino Acid Sequence: RPPRFFNEDGVIRPYRLRDGTGNQMLQVMENGRFAKYKYFTHVMINKTDMLMITRRGVLFVTKGTFGQLTCEWQYSFDEFTKEPFIVHGRRLRIEAKERVKSVF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 28.5
UniProt: Q96RL7
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.