YPT1, Recombinant, Saccharomyces Cerevisiae, aa1-206, His-SUMO-Tag (GTP-binding Protein YPT1)

Artikelnummer: USB-375896
Artikelname: YPT1, Recombinant, Saccharomyces Cerevisiae, aa1-206, His-SUMO-Tag (GTP-binding Protein YPT1)
Artikelnummer: USB-375896
Hersteller Artikelnummer: 375896
Alternativnummer: USB-375896-20,USB-375896-100
Hersteller: US Biological
Kategorie: Molekularbiologie
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. YPT1 regulates the trafficking of secretory vesicles from the endoplasmic reticulum (ER) to the Golgi. Vesicular transport depends on shuttling of YPT1 between membrane and cytosol by GDI1, probably by recycling it to its membrane of origin after a vesicle fusion event. Plays a role in the initial events of the autophagic vacuole development which take place at specialized regions of the endoplasmic reticulum. Also involved in the recycling of membrane proteins. Source: Recombinant protein corresponding to aa1-206 from saccharomyces cerevisiae YPT1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.2kD Amino Acid Sequence: MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLTNTGGGCC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 39.2
UniProt: P01123
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.