Ywhaz, Recombinant, Mouse, aa1-245, His-SUMO-Tag (14-3-3 Protein zeta/delta)

Produktübersicht

• Artikelname: Ywhaz, Recombinant, Mouse, aa1-245, His-SUMO-Tag (14-3-3 Protein zeta/delta)
• Artikelnummer: USB-375901
• Hersteller Artikelnummer: 375901
• Alternativnummer: USB-375901-20, USB-375901-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Source: Recombinant protein corresponding to aa1-245 from mouse Ywhaz, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~43.8kD Amino Acid Sequence: MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 43.8
• UniProt: P63101
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.