ZG16B, Recombinant, Human, aa53-208, HIs-Tag (Zymogen Granule Protein 16 Homolog B)

Artikelnummer: USB-375905
Artikelname: ZG16B, Recombinant, Human, aa53-208, HIs-Tag (Zymogen Granule Protein 16 Homolog B)
Artikelnummer: USB-375905
Hersteller Artikelnummer: 375905
Alternativnummer: USB-375905-20, USB-375905-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa53-208 from human ZG16B, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~21.2kD Amino Acid Sequence: GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 21.2
UniProt: Q96DA0
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.