ZipA, Recombinant, E. coli, aa1-328, His-SUMO-Tag (Cell Division Protein ZipA)

Produktübersicht

• Artikelname: ZipA, Recombinant, E. coli, aa1-328, His-SUMO-Tag (Cell Division Protein ZipA)
• Artikelnummer: USB-375906
• Hersteller Artikelnummer: 375906
• Alternativnummer: USB-375906-20, USB-375906-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Interacts directly with the cell division protein FtsZ. Probable receptor for the septal ring structure, may anchor it to the inner-membrane. Source: Recombinant protein corresponding to aa1-328 from E. coli zipA, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~52.5kD Amino Acid Sequence: MMQDLRLILIIVGAIAIIALLVHGFWTSRKERSSMFRDRPLKRMKSKRDDDSYDEDVEDDEGVGEVRVHRVNHAPANAQEHEAARPSPQHQYQPPYASAQPRQPVQQPPEAQVPPQHAPHPAQPVQQPAYQPQPEQPLQQPVSPQVAPAPQPVHSAPQPAQQAFQPAEPVAAPQPEPVAEPAPVMDKPKRKEAVIIMNVAAHHGSELNGELLLNSIQQAGFIFGDMNIYHRHLSPDGSGPALFSLANMVKPGTFDPEMKDFTTPGVTIFMQVPSYGDELQNFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKDANA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Produkteigenschaften

• Molekulargewicht: 52.5
• UniProt: P77173
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.