ZMAT5, Recombinant, Human, aa1-170, His-SUMO-Tag (Zinc Finger Matrin-type Protein 5)

Artikelnummer: USB-375908
Artikelname: ZMAT5, Recombinant, Human, aa1-170, His-SUMO-Tag (Zinc Finger Matrin-type Protein 5)
Artikelnummer: USB-375908
Hersteller Artikelnummer: 375908
Alternativnummer: USB-375908-20,USB-375908-100,USB-375908-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa1-170 from human ZMAT5, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.0kD Amino Acid Sequence: MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKRLSSAPSSRAEPIRTTVFQYPVGWPPVQELPPSLRAPPPGGWPLQPRVQWG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 36
UniProt: Q9UDW3
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.