ZNF26, Recombinant, Human, aa335-533, His-SUMO-Tag (Zinc Finger Protein 26)

Produktübersicht

• Artikelname: ZNF26, Recombinant, Human, aa335-533, His-SUMO-Tag (Zinc Finger Protein 26)
• Artikelnummer: USB-375915
• Hersteller Artikelnummer: 375915
• Alternativnummer: USB-375915-20,USB-375915-100,USB-375915-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

May be involved in transcriptional regulation. Source: Recombinant protein corresponding to aa335-533 from human ZNF26, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.6kD Amino Acid Sequence: MHTGEKPYQCSDCGKAFNMKTQLIVHQGVHTGNNPYQCGECGKAFGRKEQLTAHLRAHAGEKPYGCSECGKAFSSKSYLVIHRRTHTGERPYECSLCERAFCGKSQLIIHQRTHSTEKPYECNECEKAYPRKASLQIHQKTHSGEKPFKCSECGKAFTQKSSLSEHQRVHTGEKPWKCSECGKSFCWNSGLRIHRKTHK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 38.6
• UniProt: P17031
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.