Znf346, Recombinant, Mouse, aa1-294, His-SUMO-Tag (Zinc Finger Protein 346)

Produktübersicht

• Artikelname: Znf346, Recombinant, Mouse, aa1-294, His-SUMO-Tag (Zinc Finger Protein 346)
• Artikelnummer: USB-375917
• Hersteller Artikelnummer: 375917
• Alternativnummer: USB-375917-20,USB-375917-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Binds with low affinity to dsDNA and ssRNA, and with high affinity to dsRNA, with no detectable sequence specificity. Source: Recombinant protein corresponding to aa1-294 from mouse Znf346, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~48.7kD Amino Acid Sequence: MECPAPDATDAADPGEAGPYKGSEEPEGREPDGVRFDRERARRLWEAVSGAQPAGREEVEHMIQKNQCLFTSTQCKVCCAMLISESQKLAHYQSKKHANKVKRYLAIHGMETIKGDVKRLDSDQKSSRSKDKNHCCPICNMTFSSPAVAQSHYLGKTHAKSLKLKQQSTKGAALQQNREMLDPDKFCSLCHSTFNDPAMAQQHYMGKRHRKQETKLKLMAHYGRLADPAVSDLPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTLVTLGSQTPVQTQPTPKDSSTVQD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 48.7
• UniProt: Q9R0B7
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.