ZNF384, Recombinant, Human, aa1-245, GST-Tag (Zinc Finger Protein 384)

Produktübersicht

• Artikelname: ZNF384, Recombinant, Human, aa1-245, GST-Tag (Zinc Finger Protein 384)
• Artikelnummer: USB-375918
• Hersteller Artikelnummer: 375918
• Alternativnummer: USB-375918-20,USB-375918-100,USB-375918-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Transcription factor that binds the consensus DNA sequence [GC]AAAAA. Seems to bind and regulate the promoters of MMP1, MMP3, MMP7 and COL1A1 (By similarity). Source: Recombinant protein corresponding to aa1-245 from human ZNF384, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~53.1kD Amino Acid Sequence: MEESHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLPEKGCGLAPPHYPTLLTVPASVSLPSGISMDTESKSDQLTPHSQASVTQNITVVPVPSTGLMTAGVSCSQRWRREGSQSRGPGLVITSPSGSLVTTASSAQTFPISAPMIVSALPPGSQALQVVPDLSKKVASTLTEEGGGGGGGGGSVAPKPPRGRKKKRMLESGLPEMNDPYVLSPEDDDDHQKDGKTYRCRMCSLTFYSKSEMQI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 53.1
• UniProt: Q8TF68
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.