ZNF581, Recombinant, Human, aa1-197, His-SUMO-Tag (Zinc Finger Protein 581)

Produktübersicht

• Artikelname: ZNF581, Recombinant, Human, aa1-197, His-SUMO-Tag (Zinc Finger Protein 581)
• Artikelnummer: USB-375919
• Hersteller Artikelnummer: 375919
• Alternativnummer: USB-375919-20,USB-375919-100,USB-375919-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

May be involved in transcriptional regulation. Source: Recombinant protein corresponding to aa1-197 from human ZNF581, fused to His-SUMO-Tag expressed in Molecular Weight: ~38kD Amino Acid Sequence: MLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQASSPPRPNHYLLIDTQGVPYTVLVDEESQREPGASGAPGQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDICGKAFKRASHLARHHSIHLAGGGRPHGCPLCPRRFRDAGELAQHSRVHSGERPFQCPHCPRRFMEQNTLQKHTRWKHP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 38
• UniProt: Q9P0T4
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.