MUC2 (Mucin-2, MUC-2, Intestinal Mucin-2, SMUC), Rabbit

Artikelnummer: USB-397480
Artikelname: MUC2 (Mucin-2, MUC-2, Intestinal Mucin-2, SMUC), Rabbit
Artikelnummer: USB-397480
Hersteller Artikelnummer: 397480
Alternativnummer: USB-397480-100
Hersteller: US Biological
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Immunogen: Synthetic peptide corresponding to a sequence DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD of human MUC2.
Mucin 2, also known as MUC2, is a protein that in humans is encoded by the MUC2 gene. This gene encodes a member of the mucin protein family. It is mapped to 11p15.5. Mucin 2 is particularly prominent in the gut where it is secreted from goblet cells in the epithelial lining into the lumen of the large intestine. There, mucin 2, along with small amounts of related-mucin proteins, polymerizes into a gel of which 80% by weight is oligosaccharide side-chains that are added as post-translational modifications to the mucin proteins. This gel provides an insoluble mucous barrier that serves to protect the intestinal epithelium. The primary function of the MUC2 gene product is to provide a protective barrier between the epithelial surfaces and the gut lumen. There is decreased expression of MUC2 in colonic cancer and defective polymerization of secreted mucin in ulcerative colitis. Applications: Suitable for use in Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (paraffin): 0.5-1ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
UniProt: Q02817
Reinheit: Purified by immunoaffinity chromatography.
Formulierung: Supplied as a lyophilized powder from PBS, 0.05% sodium azide, 4% trehalose. Reconstitute with 200ul sterile ddH2O.