SCNN1A (Amiloride-Sensitive Sodium Channel Subunit Alpha, Alpha-NaCH, Epithelial Na(+) Channel Subunit Alpha, Alpha-ENaC, ENaCA, Nonvoltage-Gated Sodium Channel 1 Subunit Alpha, SCNEA, SCNN1), Rabbit

Artikelnummer: USB-397544
Artikelname: SCNN1A (Amiloride-Sensitive Sodium Channel Subunit Alpha, Alpha-NaCH, Epithelial Na(+) Channel Subunit Alpha, Alpha-ENaC, ENaCA, Nonvoltage-Gated Sodium Channel 1 Subunit Alpha, SCNEA, SCNN1), Rabbit
Artikelnummer: USB-397544
Hersteller Artikelnummer: 397544
Alternativnummer: USB-397544-100
Hersteller: US Biological
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: Synthetic peptide corresponding to a sequence QEWVFQMLSRQNNYTVNNKRNGVAKVNIFFKELNYK of human SCNN1A.
The SCNN1A gene encodes the alpha subunit of the epithelial sodium channel (ENaC), a constitutively active channel that allows the flow of sodium ions from the lumen into epithelial cells across the apical cell membrane. The ENaC channel, which is regulated by the renin-angiotensin-aldosterone system, has a central role in the regulation of extracellular fluid volume and blood pressure. The other subunits are encoded by the beta (SCNN1B), gamma (SCNN1G), and delta (SCNN1D) genes. This SCNN1A gene is mapped to 12p13.31. Mutations in this gene have been associated with pseudohypoaldosteronism type 1 (PHA1), a rare salt wasting disease resulting from target organ unresponsiveness to mineralocorticoids. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
UniProt: P37088
Reinheit: Purified by immunoaffinity chromatography.
Formulierung: Supplied as a lyophilized powder from PBS, 0.05% sodium azide, 4% trehalose. Reconstitute with 200ul sterile ddH2O.