Acidic Protein MsyB, Recombinant, E. coli, aa1-124, His-tag (msyB)

Artikelnummer: USB-405859
Artikelname: Acidic Protein MsyB, Recombinant, E. coli, aa1-124, His-tag (msyB)
Artikelnummer: USB-405859
Hersteller Artikelnummer: 405859
Alternativnummer: USB-405859-20, USB-405859-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Could participate in the normal pathway of protein export. Source: Full-length recombinant protein corresponding to aa1-124 from E. coli Acidic Protein MsyB, fused to His-tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~16.3kD Amino Acid Sequence: MTMYATLEEAIDAAREEFLADNPGIDAEDANVQQFNAQKYVLQDGDIMWQVEFFADEGEEGECLPMLSGEAAQSVFDGDYDEIEIRQEWQEENTLHEWDEGEFQLEPPLDTEEGRAAADEWDER Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 16.3
UniProt: P25738
Reinheit: ~85% (SDS-PAGE)
Formulierung: Supplied as a liquid in 10mM Tris-HCl, pH 8.0, 1mM EDTA, 10% glycerol.