Acyl Carrier Protein, Recombinant, E. coli, aa1-78, His-SUMO-Tag (acpP)

Artikelnummer: USB-405860
Artikelname: Acyl Carrier Protein, Recombinant, E. coli, aa1-78, His-SUMO-Tag (acpP)
Artikelnummer: USB-405860
Hersteller Artikelnummer: 405860
Alternativnummer: USB-405860-20,USB-405860-100,USB-405860-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Full-length recombinant protein corresponding to aa1-78 from E. coli Acyl carrier protein, fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli.. Uniprot/Accession: P0A6A8. Molecular Weight: ~24.6kD Amino Acid Sequence: MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 24.6
UniProt: P0A6A8
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a liquid in 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 50% glycerol.