Dedicator of Cytokinesis Protein 8, Recombinant, Human, aa560-729, His-tag (DOCK8)

Artikelnummer: USB-405902
Artikelname: Dedicator of Cytokinesis Protein 8, Recombinant, Human, aa560-729, His-tag (DOCK8)
Artikelnummer: USB-405902
Hersteller Artikelnummer: 405902
Alternativnummer: USB-405902-20,USB-405902-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Potential guanine nucleotide exchange factor (GEF). GEF proteins activate some small GTPases by exchanging bound GDP for free GTP. Is involved in NK cell cytotoxicity by controlling polarization of microtubule-organizing center (MTOC), and possibly regulating CCDC88B-mediated lytic granule transport to MTOC during cell killing Partial recombinant protein corresponding to aa560-729 from human Dedicator of cytokinesis protein 8, fused to His-tag at N-terminal, expressed in Yeast. Molecular Weight: ~21.8kD Amino Acid Sequence: RNLLYVYPQRLNFVNKLASARNITIKIQFMCGEDASNAMPVIFGKSSGPEFLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASVETLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molekulargewicht: 21.8
UniProt: Q8NF50
Reinheit: ~85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.