Endochitinase, Recombinant, Avena Sativa, aa1-200, His-tag

Artikelnummer: USB-405916
Artikelname: Endochitinase, Recombinant, Avena Sativa, aa1-200, His-tag
Artikelnummer: USB-405916
Hersteller Artikelnummer: 405916
Alternativnummer: USB-405916-20,USB-405916-100
Hersteller: US Biological
Kategorie: Molekularbiologie
This protein functions as a defense against chitin-containing fungal pathogens. Source: Recombinant protein corresponding to aa1-200 from avena sativa Endochitinase, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~25.7D Amino Acid Sequence: VSSVISSSLFEKMLLHRGFYTYDAFIAAAKSFPAFATTGSTDVRKREVAAFLAQTSHETTGGWPTAPDGPYELGSTSDYFGRGPIQISYNYNYGAAGKAIGVDLLRNPDLVTSDNTVEFKTALWFWMTPQSPKPSSHDVITGRWSPSSTDKAAGRVPGYGVLTNIIDGGVECGKGQESHVADRIGYYKDNLDCYNQKPFA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 25.7
UniProt: P86181
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.