Heat Shock Protein HSP 90-alpha, Recombinant, Porcine, aa222-367, His-Tag (HSP90AA1)

Produktübersicht

• Artikelname: Heat Shock Protein HSP 90-alpha, Recombinant, Porcine, aa222-367, His-Tag (HSP90AA1)
• Artikelnummer: USB-405937
• Hersteller Artikelnummer: 405937
• Alternativnummer: USB-405937-20,USB-405937-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function (By similarity). Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion (By similarity). Partial recombinant protein corresponding to aa222-367 from porcine Heat shock protein HSP 90-alpha, fused to 6X His-Tag at N-terminal, expressed in Baculovirus. Molecular Weight: ~19.7kD AA Sequence: VEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKLYVR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 19.7
• UniProt: O02705
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.