Heat-labile Enterotoxin A Chain, Recombinant, E. coli, aa19-258, His-SUMO-tag, Myc-tag (eltA)

Produktübersicht

• Artikelname: Heat-labile Enterotoxin A Chain, Recombinant, E. coli, aa19-258, His-SUMO-tag, Myc-tag (eltA)
• Artikelnummer: USB-405938
• Hersteller Artikelnummer: 405938
• Alternativnummer: USB-405938-20,USB-405938-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase. Source: Recombinant protein corresponding to aa19-258 from Escherichia Coli Heat-labile Enterotoxin A Chain, fused to His-SUMO-tag at N-terminal and fused to Myc-tag at C-terminal, expressed in E. coli. Molecular Weight: ~45.3kD Amino Acid Sequence: NGDRLYRADSRPPDEIKRSGGLMPRGHNEYFDRGTQMNINLYDHARGTQTGFVRYDDGYVSTSLSLRSAHLAGQSILSGYSTYYIYVIATAPNMFNVNDVLGVYSPHPYEQEVSALGGIPYSQIYGWYRVNFGVIDERLHRNREYRDRYYRNLNIAPAEDGYRLAGFPPDHQAWREEPWIHHAPQGCGNSSRTITGDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 45.3
• UniProt: P06717
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.