HLA Class I Histocompatibility Antigen, alpha Chain G, Recombinant, Human, aa25-308, His-SUMO-tag (HLA-G)

Artikelnummer: USB-405948
Artikelname: HLA Class I Histocompatibility Antigen, alpha Chain G, Recombinant, Human, aa25-308, His-SUMO-tag (HLA-G)
Artikelnummer: USB-405948
Hersteller Artikelnummer: 405948
Alternativnummer: USB-405948-20,USB-405948-100,USB-405948-1
Hersteller: US Biological
Kategorie: Molekularbiologie
nvolved in the presentation of foreign antigens to the immune system. Plays a role in maternal tolerance of the fetus by mediating protection from the deleterious effects of natural killer cells, cytotoxic T-lymphocytes, macrophages and mononuclear cells. Source: Partial recombinant protein corresponding to aa25-308 from human HLA class I Histocompatibility Antigen, alpha Chain G , fused to 6xHis-SUMO-tag at N-terminal, expressed in E. coli. Molecular Weight: ~48.7kD Amino Acid Sequence: GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 48.7
UniProt: P17693
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.