Metallothionein-3, Recombinant, Human, aa1-68, GST-tag (MT3)

Artikelnummer: USB-405988
Artikelname: Metallothionein-3, Recombinant, Human, aa1-68, GST-tag (MT3)
Artikelnummer: USB-405988
Hersteller Artikelnummer: 405988
Alternativnummer: USB-405988-20,USB-405988-100,USB-405988-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Binds heavy metals. Contains three zinc and three copper atoms per polypeptide chain and only a negligible amount of cadmium. Inhibits survival and neurite formation of cortical neurons in vitro. Source: Recombinant protein corresponding to aa1-68 from human Metallothionein-3, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~33.9kD Amino Acid Sequence: MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 33.9
UniProt: P25713
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.