Ovomucoid, Recombinant, Coturnix Delegorguei, aa1-52, His-SUMO-Tag, Myc-Tag

Artikelnummer: USB-406011
Artikelname: Ovomucoid, Recombinant, Coturnix Delegorguei, aa1-52, His-SUMO-Tag, Myc-Tag
Artikelnummer: USB-406011
Hersteller Artikelnummer: 406011
Alternativnummer: USB-406011-20,USB-406011-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa1-52 from Coturnix delegorguei Ovomucoid, fused to His-SUMO-Tag at N-terminal and fused to Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~25.7kD Amino Acid Sequence: SVDCSEYPKPACPKDYRPVCGSDNKTYGNKCNFCNAVVESNGTLTLNRFGKC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 25.7
UniProt: P05600
Reinheit: ~90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.