Oxytocin-neurophysin 1, Recombinant, Human, aa32-125, His-tag (OXT)

Artikelnummer: USB-406013
Artikelname: Oxytocin-neurophysin 1, Recombinant, Human, aa32-125, His-tag (OXT)
Artikelnummer: USB-406013
Hersteller Artikelnummer: 406013
Alternativnummer: USB-406013-20,USB-406013-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Neurophysin 1 specifically binds oxytocin.Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Source: Recombinant protein corresponding to aa32-125 from Human Oxytocin-neurophysin 1, fused to His-tag at N-terminal, expressed in Yeast. Molecular Weight: ~11.6kD Amino Acid Sequence: AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 11.6
UniProt: P01178
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.