Peroxiredoxin-2, Recombinant, Human, aa2-198, His-tag (PRDX2)

Artikelnummer: USB-406019
Artikelname: Peroxiredoxin-2, Recombinant, Human, aa2-198, His-tag (PRDX2)
Artikelnummer: USB-406019
Hersteller Artikelnummer: 406019
Alternativnummer: USB-406019-20,USB-406019-100,USB-406019-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2. Source: Recombinant protein corresponding to aa2-198 from human Peroxiredoxin-2, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~25.8kD Amino Acid Sequence: ASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 25.8
UniProt: P32119
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.