Protein corresponding to aa1-137 from full length human ZD52F10.
This gene is upregulated in inflammatory diseases, and it was first observed as expressed in the differentiated layers of skin. The most interesting aspect of this gene is the differential use of promoters and terminators to generate isoforms with unique cellular distributions and domain compliments. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene, but the full-length nature of some of them has not been determined. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MFNFDTFWKNFKSKLGFINWDAINKNQVPPPSTRALL YFSRLWEDFKQNTPFLNWKAIIEGADASSLQKRAGRA DQPGAGWQEVAAVTSKNYNYNPHAYPTAYGGKYSVK TPAKGGVSPSSSASRVQPGLLQWVKFW Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.