ZNF398 (KIAA1339, P51, P71, ZER6), Mouse

Artikelnummer: USB-470209
Artikelname: ZNF398 (KIAA1339, P51, P71, ZER6), Mouse
Artikelnummer: USB-470209
Hersteller Artikelnummer: 470209
Alternativnummer: USB-470209-50
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: IF, WB
Immunogen: Protein corresponding to aa1-642 from full length human ZNF398.
This gene encodes a member of the Kruppel family of C2H2-type zinc-finger transcription factor proteins. The encoded protein acts as a transcriptional activator. Two transcript variants encoding distinct isoforms have been identified for this gene. Other transcript variants have been described, but their full length sequence has not been determined. [provided by RefSeq] Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAEAAPAPTSEWDSECLTSLQPLPLPTPPAANEAHLQ TAAISLWTVVAAVQAIERKVEIHSRRLLHLEGRTGTAEK KLASCEKTVTELGNQLEGKWAVLGTLLQEYGLLQRRL ENLENLLRNRNFWILRLPPGIKGDIPKVPVAFDDVSIYF STPEWEKLEEWQKELYKNIMKGNYESLISMDYAINQP DVLSQIQPEGEHNTEDQAGPEESEIPTDPSEEPGISTS DILSWIKQEEEPQVGAPPESKESDVYKSTYADEELVIK AEGLARSSLCPEVPVPFSSPPAAAKDAFSDVAFKSQQ STSMTPFGRPATDLPEASEGQVTFTQLGSYPLPPPVG EQVFSCHHCGKNLSQDMLLTHQCSHATEHPLPCAQC PKHFTPQADLSSTSQDHASETPPTCPHCARTFTHPSR LTYHLRVHNSTERPFPCPDCPKRFADQARLTSHRRAH ASERPFRCAQCGRSFSLKISLLLHQRGHAQERPFSCP QCGIDFNGHSALIRHQMIHTGERPYPCTDCSKSFMRK EHLLNHRRLHTGERPFSCPHCGKSFIRKHHLMKHQRI HTGERPYPCSYCGRSFRYKQTLKDHLRSGHNGGCGG DSDPSGQPPNPPGPLITGLETSGLGVNTEGLETNQWY GEGSGGGVL Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 170686
Reinheit: Purified
Formulierung: Supplied as a liquid in PBS, pH 7.4