ZSWIM7 (SWS1), Mouse

Artikelnummer: USB-470215
Artikelname: ZSWIM7 (SWS1), Mouse
Artikelnummer: USB-470215
Hersteller Artikelnummer: 470215
Alternativnummer: USB-470215-50
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: WB
Immunogen: Protein corresponding to aa1-140 from full length human ZSWIM7.
Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA sequence: MAVVLPAVVEELLSEMAAAVQESARIPDEYLLSLKFLF GSSATQALDLVDRQSITLISSPSGRRVYQVLGSSSKTY TCLASCHYCSCPAFAFSVLRKSDSILCKHLLAVYLSQV MRTCQQLSVSDKQLTDILLMEKKQEA Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 153132
Reinheit: Purified
Formulierung: Supplied as a liquid in PBS, pH 7.4