ATP5B (ATP Synthase Subunit Beta, Mitochondrial, ATP Synthase, H+ Transporting, Mitochondrial F1 Complex, Beta Polypeptide, Rabbit
Artikelnummer:
USB-475916
- Bilder (0)
| Artikelname: | ATP5B (ATP Synthase Subunit Beta, Mitochondrial, ATP Synthase, H+ Transporting, Mitochondrial F1 Complex, Beta Polypeptide, Rabbit |
| Artikelnummer: | USB-475916 |
| Hersteller Artikelnummer: | 475916 |
| Alternativnummer: | USB-475916-100 |
| Hersteller: | US Biological |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, IP, WB |
| Immunogen: | Synthetic peptide corresponding to within MGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEH at the C-terminal region of human ATP5B |
| ATP5B is a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). ATP5B is the beta subunit of the catalytic core.This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the beta subunit of the catalytic core. Applications: Suitable for use in Immunohistochemistry, Immunoprecipitation and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Positive Control: Mouse brain homogenate Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. |
Produktgarantie und fachkundiger Support
