HSP90AB1 (Heat Shock Protein HSP 90-Beta, Heat Shock Protein 90 Alpha (Cytosolic), Class B Member 1), Rabbit
Artikelnummer:
USB-483148
- Bilder (0)
| Artikelname: | HSP90AB1 (Heat Shock Protein HSP 90-Beta, Heat Shock Protein 90 Alpha (Cytosolic), Class B Member 1), Rabbit |
| Artikelnummer: | USB-483148 |
| Hersteller Artikelnummer: | 483148 |
| Alternativnummer: | USB-483148-100 |
| Hersteller: | US Biological |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Immunogen: | Synthetic peptide located within the following region of HSP90AB1: NASDALDKIRYESLTDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTK |
| Hsp90ab1 is a molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. |
Produktgarantie und fachkundiger Support
