POU5F1 (POU Domain, Class 5, Transcription Factor 1), Rabbit

Artikelnummer: USB-489069
Artikelname: POU5F1 (POU Domain, Class 5, Transcription Factor 1), Rabbit
Artikelnummer: USB-489069
Hersteller Artikelnummer: 489069
Alternativnummer: USB-489069-100
Hersteller: US Biological
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: Synthetic peptide corresponding to the following region, PCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYT, from the N-terminal region of human POU5F1. Species Sequence Homology: canine, goat, porcine and rabbit
This gene encodes a transcription factor containing a POU homeodomain that plays a key role in embryonic development and stem cell pluripotency. Aberrant expression of this gene in adult tissues is associated with tumorigenesis. This gene can participate in a translocation with the Ewings sarcoma gene on chromosome 21, which also leads to tumor formation. Alternative splicing, as well as usage of alternative AUG and non-AUG translation initiation codons, results in multiple isoforms. One of the AUG start codons is polymorphic in human populations. Related pseudogenes have been identified on chromosomes 1, 3, 8, 10, and 12. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 1.25ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 001272916
UniProt: Q01860
Reinheit: Purified by affinity chromatography.
Formulierung: Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.