Angiogenin-4, Recombinant, Mouse, aa25-144, His-Sumo-Tag, Myc-Tag (Ang4)

Artikelnummer: USB-517801
Artikelname: Angiogenin-4, Recombinant, Mouse, aa25-144, His-Sumo-Tag, Myc-Tag (Ang4)
Artikelnummer: USB-517801
Hersteller Artikelnummer: 517801
Alternativnummer: USB-517801-20,USB-517801-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Has bactericidal activity against E. faecalis and L. monocytogenes, but not against L. innocua and E. coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro). Source: Recombinant protein corresponding to aa25-144 of mouse Angiogenin-4, fused to 6xHis-Sumo-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~31.4kD Amino Acid Sequence: QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 31.4
UniProt: Q3TMQ6
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.