Antitoxin RelB, Recombinant, E. coli, aa1-79, His-Tag, Myc-Tag (RelB)

Produktübersicht

• Artikelname: Antitoxin RelB, Recombinant, E. coli, aa1-79, His-Tag, Myc-Tag (RelB)
• Artikelnummer: USB-517805
• Hersteller Artikelnummer: 517805
• Alternativnummer: USB-517805-20,USB-517805-200
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Antitoxin component of a type II toxin-antitoxin (TA) system. Counteracts the effect of cognate toxin RelE via direct protein-protein interaction, preventing RelE from entering the ribosome A site and thus inhibiting its endoribonuclease activity. An autorepressor of relBE operon transcription. 2 RelB dimers bind to 2 operator sequences, DNA-binding and repression is stronger when complexed with toxin/corepressor RelE by conditional cooperativity. Increased transcription rate of relBE and activation of relE is consistent with a lower level of RelB in starved cells due to degradation of RelB by protease Lon. Source: Recombinant full length protein corresponding to aa1-79 of E. coli Antitoxin RelB, fused to 10xHis-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~16.1kD Amino Acid Sequence: MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 16.1
• UniProt: P0C079
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.