Azurin, Recombinant, Bordetella Bronchiseptica, aa22-150, His-Tag, Myc-Tag (BB3856)

Produktübersicht

• Artikelname: Azurin, Recombinant, Bordetella Bronchiseptica, aa22-150, His-Tag, Myc-Tag (BB3856)
• Artikelnummer: USB-517815
• Hersteller Artikelnummer: 517815
• Alternativnummer: USB-517815-20,USB-517815-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa22-150 of Bordetella Bronchiseptica Azurin, fused to 10xHis-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Yeast. Molecular Weight: ~17.8kD Amino Acid Sequence: AECSVDIAGTDQMQFDKKAIEVSKSCKQFTVNLKHTGKLPRNVMGHNWVLTKTADMQAVEKDGIAAGLDNQYLKAGDTRVLAHTKVLGGGESDSVTFDVAKLAAGDDYTFFCSFPGHGALMKGTLKLVD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 17.8
• UniProt: P0A321
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.