Beta-Galactoside-Specific Lectin 1, Recombinant, Viscum Album, aa34-287, His-Tag

Artikelnummer: USB-517822
Artikelname: Beta-Galactoside-Specific Lectin 1, Recombinant, Viscum Album, aa34-287, His-Tag
Artikelnummer: USB-517822
Hersteller Artikelnummer: 517822
Alternativnummer: USB-517822-20,USB-517822-100
Hersteller: US Biological
Kategorie: Molekularbiologie
The A chain is responsible for inhibiting protein synthesis through the catalytic inactivation of 60S ribosomal subunits by removing adenine from position 4,324 of 28S rRNA. The B chain binds to cell receptors and probably facilitates the entry into the cell of the A chain, B chains are also responsible for cell agglutination (lectin activity). Inhibits growth of the human tumor cell line Molt4. Source: Recombinant protein corresponding to aa34-287 of Viscum Album Beta-Galactoside-Specific Lectin 1, fused to 6xHis-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~30.4kD Amino Acid Sequence: YERLRLRVTHQTTGEEYFRFITLLRDYVSSGSFSNEIPLLRQSTIPVSDAQRFVLVELTNEGGDSITAAIDVTNLYVVAYQAGDQSYFLRDAPRGAETHLFTGTTRSSLPFNGSYPDLERYAGHRDQIPLGIDQLIQSVTALRFPGGSTRTQARSILILIQMISEAARFNPILWRARQYINSGASFLPDVYMLELETSWGQQSTQVQQSTDGVFNNPIRLAIPPGNFVTLTNVRDVIASLAIMLFVCGERPSSS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 30.4
UniProt: P81446
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.