Cathepsin O, Recombinant, Human, aa108-321, His-Tag, Myc-Tag (CTSO)

Produktübersicht

• Artikelname: Cathepsin O, Recombinant, Human, aa108-321, His-Tag, Myc-Tag (CTSO)
• Artikelnummer: USB-517838
• Hersteller Artikelnummer: 517838
• Alternativnummer: USB-517838-20,USB-517838-200
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover. Source: Recombinant protein corresponding to aa108-321 of human Cathepsin O, fused to 10xHis-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~28.5kD Amino Acid Sequence: LPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 28.5
• UniProt: P43234
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.