Complement C1q Tumor Necrosis Factor-Related Protein 3, Recombinant, Mouse, aa23-246, His-Tag, Myc-Tag (C1QTNF3)

Artikelnummer: USB-517849
Artikelname: Complement C1q Tumor Necrosis Factor-Related Protein 3, Recombinant, Mouse, aa23-246, His-Tag, Myc-Tag (C1QTNF3)
Artikelnummer: USB-517849
Hersteller Artikelnummer: 517849
Alternativnummer: USB-517849-20,USB-517849-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa23-246 of mouse Complement C1q Tumor Necrosis Factor-Related Protein 3, fused to 10xHis-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~31.1kD Amino Acid Sequence: QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 31.1
UniProt: Q9ES30
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.