Cyanovirin-N, Recombinant, Nostoc Ellipsosporum, aa1-101, His-Tag

Artikelnummer: USB-517856
Artikelname: Cyanovirin-N, Recombinant, Nostoc Ellipsosporum, aa1-101, His-Tag
Artikelnummer: USB-517856
Hersteller Artikelnummer: 517856
Alternativnummer: USB-517856-20,USB-517856-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Its activity in situ is unknown, however it acts as a viral entry inhibitor, inhibiting HIV-1, HIV-2 and simian immunodeficiency virus (and some other viruses such as feline immunodeficiency virus, measles virus and human herpesvirus) infection and replication. It prevents essential interactions between the envelope glycoprotein and target cell receptors by binding to carbohydrates on viral protein gp120 and possibly by other mechanisms as well. Addition to cells must occur before or shortly after virus addition. It also inhibits cell-to-cell fusion, and virus-to-cell and cell-to-cell transmission of a viral infection. Is remarkably stabile, the protein can withstand multiple freeze-thaw cycles, dissolution in organic solvents, treatment with salt, detergent, H2O2 and boiling without significant loss of anti-HIV activity. Source: Recombinant protein corresponding to aa1-101 of Nostoc Ellipsosporum Cyanovirin-N, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~15kD Amino Acid Sequence: LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 15
UniProt: P81180
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.