Glucocorticoid Receptor, Recombinant, Human, aa521-777, His-Trx-Tag (NR3C1, Nuclear Receptor Subfamily 3 Group C Member 1, GRL)

Produktübersicht

• Artikelname: Glucocorticoid Receptor, Recombinant, Human, aa521-777, His-Trx-Tag (NR3C1, Nuclear Receptor Subfamily 3 Group C Member 1, GRL)
• Artikelnummer: USB-517927
• Hersteller Artikelnummer: 517927
• Alternativnummer: USB-517927-20,USB-517927-200
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Receptor for glucocorticoids (GC). Has a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE), both for nuclear and mitochondrial DNA, and as a modulator of other transcription factors. Affects inflammatory responses, cellular proliferation and differentiation in target tissues. Involved in chromatin remodeling. Plays a role in rapid mRNA degradation by binding to the 5 UTR of target mRNAs and interacting with PNRC2 in a ligand-dependent manner which recruits the RNA helicase UPF1 and the mRNA-decapping enzyme DCP1A, leading to RNA decay. Could act as a coactivator for STAT5-dependent transcription upon growth hormone (GH) stimulation and could reveal an essential role of hepatic GR in the control of body growth. Source: Partial recombinant protein corresponding to aa521-777 of human Glucocorticoid Receptor, fused to 6xHis-Trx-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~47.8kD AA Sequence: VPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 47.8
• UniProt: P04150
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.