HLA Class I Histocompatibility Antigen, A-1 Alpha Chain, Recombinant, Human, aa25-308, His-Tag (HLA-A)

Produktübersicht

• Artikelname: HLA Class I Histocompatibility Antigen, A-1 Alpha Chain, Recombinant, Human, aa25-308, His-Tag (HLA-A)
• Artikelnummer: USB-517953
• Hersteller Artikelnummer: 517953
• Alternativnummer: USB-517953-20,USB-517953-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Involved in the presentation of foreign antigens to the immune system. Source: Partial recombinant protein corresponding to aa25-308 of human HLA Class I Histocompatibility Antigen, A-1 Alpha Chain, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.7kD Amino Acid Sequence: GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 36.7
• UniProt: P30443
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.