HLA-DMA Protein, Recombinant Human, aa27-233, His-Tag (HLA-DMA)

Artikelnummer: USB-517955
Artikelname: HLA-DMA Protein, Recombinant Human, aa27-233, His-Tag (HLA-DMA)
Artikelnummer: USB-517955
Hersteller Artikelnummer: 517955
Alternativnummer: USB-517955-20,USB-517955-100,USB-517955-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Partial recombinant protein corresponding to aa27-233 of human HLA-DMA Protein, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.4kD Amino Acid Sequence: VPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 27.4
UniProt: Q6ICR9
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.