Holliday Junction ATP-Dependent DNA Helicase RuvB, Recombinant, E. coli, aa1-336, His-Sumo-Tag (RuvB)

Produktübersicht

• Artikelname: Holliday Junction ATP-Dependent DNA Helicase RuvB, Recombinant, E. coli, aa1-336, His-Sumo-Tag (RuvB)
• Artikelnummer: USB-517956
• Hersteller Artikelnummer: 517956
• Alternativnummer: USB-517956-20,USB-517956-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

The RuvA-RuvB complex in the presence of ATP renatures cruciform structure in supercoiled DNA with palindromic sequence, indicating that it may promote strand exchange reactions in homologous recombination. RuvAB is a helicase that mediates the Holliday junction migration by localized denaturation and reannealing. Source: Recombinant protein corresponding to aa1-336 of E. coli Holliday Junction ATP-Dependent DNA Helicase RuvB, fused to 6xHis-Sumo-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~53.2kD Amino Acid Sequence: MIEADRLISAGTTLPEDVADRAIRPKLLEEYVGQPQVRSQMEIFIKAAKLRGDALDHLLIFGPPGLGKTTLANIVANEMGVNLRTTSGPVLEKAGDLAAMLTNLEPHDVLFIDEIHRLSPVVEEVLYPAMEDYQLDIMIGEGPAARSIKIDLPPFTLIGATTRAGSLTSPLRDRFGIVQRLEFYQVPDLQYIVSRSARFMGLEMSDDGALEVARRARGTPRIANRLLRRVRDFAEVKHDGTISADIAAQALDMLNVDAEGFDYMDRKLLLAVIDKFFGGPVGLDNLAAAIGEERETIEDVLEPYLIQQGFLQRTPRGRMATTRAWNHFGITPPEMP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 53.2
• UniProt: P0A812
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.