Insulin-Like Growth Factor I, Recombinant, Human, aa49-118, His-Tag (IGF1)

Produktübersicht

• Artikelname: Insulin-Like Growth Factor I, Recombinant, Human, aa49-118, His-Tag (IGF1)
• Artikelnummer: USB-517964
• Hersteller Artikelnummer: 517964
• Alternativnummer: USB-517964-20,USB-517964-100,USB-517964-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in rat bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation. Source: Recombinant protein corresponding to aa49-118 of human Insulin-Like Growth Factor I, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~13.2kD Amino Acid Sequence: GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 13.2
• UniProt: P05019
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.