Interferon Type B, Recombinant, Chicken, aa28-203, His-Tag (IFNB)

Produktübersicht

• Artikelname: Interferon Type B, Recombinant, Chicken, aa28-203, His-Tag (IFNB)
• Artikelnummer: USB-517968
• Hersteller Artikelnummer: 517968
• Alternativnummer: USB-517968-20,USB-517968-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Has antiviral activities. Source: Recombinant protein corresponding to aa28-203 of chicken Interferon Type B, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.8kD Amino Acid Sequence: CNHLRHQDANFSWKSLQLLQNTAPPPPQPCPQQDVTFPFPETLLKSKDKKQAAITTLRILQHLFNMLSSPHTPKHWIDRTRHSLLNQIQHYIHHLEQCFVNQGTRSQRRGPRNAHLSINKYFRSIHNFLQHNNYSACTWDHVRLQARDCFRHVDTLIQWMKSRAPLTASSKRLNTQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 24.8
• UniProt: Q90873
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.